China Projects

AI Prompts and Official-Account Ops Deep-Analysis Course, Revealing Underlying Logic

📚Video Course
📂Artificial Intelligence (AI)
🕒Last updated: 05/22/2024
👥Entrepreneurs / Self-media creators / Cross-border e-commerce sellers / Side-hustlers
Study material — included with membership
Unlock Course with Membership
🔓
Get this course for reference study with membership
📦
Join membership — study all 16741 courses & software tools as reference
🔄
Courses keep updating — members study new material as it arrives
Share:
Top Selling Courses
Top Selling Software Tools
Description

Course content:

\

1. 1course：detailed explanationOfficial Accounttrafficgettakemachinesystem.mp4
\ 2. 2course：Official Accountpagefacequicklysettingsandoutfitrepairtechniques.mp4
\ 3. 3course：revealedefficientviraltextstrategy，learnmemberhotreviewcourse.mp4
\ 4. 5course：deepdeconstructAItechnologyandOfficial Accountviraltextcreateworkshop.mp4
\ 5. 6course：AIpromptadvanceduseandfrommove-izationtechniques.mp4
\ 6. 7course：hands-onperformshow：AIpromptwriteprocess.mp4

Related Courses

Study material — included with membership Get Membership

Family Comedy Short-Drama Creation Course: Benchmark Hot Accounts, AI-Assisted, Fast Start for Total Beginners, Grow Followers and Drive Product Sales

Study material — included with membership Get Membership

Amazon AI Automation Practical Course: AI Operating Mindset, Setting Up the Codex Environment, Risk-Control Checks and Automated Listing Copy

Study material — included with membership Get Membership

AI E-Commerce Data Tool Development Course: Learn Codex+BI From Zero, Build a Multi-Store Integrated Visualization Dashboard

Study material — included with membership Get Membership

Codex Commercial Implementation Practical Course: Software Installation & Maintenance, Master Multi-Domain Applications, Full Coverage of Video Generation, Development and Operations

Study material — included with membership Get Membership

Advanced AI Prompt Application: 15 Lessons | Universal Instruction Thinking + Multiple Output Modes + Full Industry Commercial Cases

Study material — included with membership Get Membership

AI Video Creation Crash Course: From Great-Case Breakdown to Five Core Modules, Fast-Track AI Video Skills for Total Beginners

Study material — included with membership Get Membership

AI Commercial Practice System Course: In-Depth SD Mastery + Advanced Flux Hands-On + Comfyui Workflow Building, Full Commercial Design Project Training

Study material — included with membership Get Membership

[National-Day Pick] AI Automation Game, 1k+ RMB a Day, Simple to Operate, Stable for Three Years! [Revealed]

Study material — included with membership Get Membership

AI Comic-Drama Director-Level Creation Practice: Prompts + Cinematography + Characters & Scenes + Dynamic Storyboards + AI Video Generation + Professional Editing System

Study material — included with membership Get Membership

AI True-Crime Reconstruction Course by an 80K-Follower Douyin Blogger: Beginners Can Make Suspense Content with Millions of Plays, Seize the AI Boom and Tell Every Real Story with AI

China Projects
China Projects — one person, one company. No team, no middlemen. Every model here is already proven in China. Join the membership, study it as reference, and launch it locally in your country.

Categories

Solo Business Courses
Software & Tools

Quick Links

Policies

  • Privacy Policy
  • Terms of Service
  • Refund Support
  • Support Policy

Stay Updated

Home
Categories
Cart (0)
Notifications
Account
We use cookies to ensure you get the best experience on our website. By continuing to browse, you agree to our use of cookies.